DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CIPK18

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_174217.1 Gene:CIPK18 / 839797 AraportID:AT1G29230 Length:520 Species:Arabidopsis thaliana


Alignment Length:322 Identity:102/322 - (31%)
Similarity:174/322 - (54%) Gaps:30/322 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SPNESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKN--MLSGARPSTNFSD 221
            ||..:|     :...|.:.:.||.|.:..|.|..:.::..:.|:|::.|.  |.||.        
plant    64 SPRNNI-----LMGKYELGKLLGHGTFAKVYLAQNIKSGDKVAIKVIDKEKIMKSGL-------- 115

  Fly   222 PDRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQ 286
            ...:..|..|::.:.||.:|.:.:::.....:|.|:|::.||:|.|.:...: |.|:.::.||.|
plant   116 VAHIKREISILRRVRHPYIVHLFEVMATKSKIYFVMEYVGGGELFNTVAKGR-LPEETARRYFQQ 179

  Fly   287 MCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLS---KFVQKDSVMRTLCGTPLYVA 348
            :..:|.:.|.||:.||||||:|:||   |.:..|||||||||   :.:::|.:..|.||||.|:|
plant   180 LISSVSFCHGRGVYHRDLKPENLLL---DNKGNLKVSDFGLSAVAEQLRQDGLCHTFCGTPAYIA 241

  Fly   349 PEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQR 413
            ||||...|.:|  .|.|:||.||:||..::|.:||.|:......::|.||.|..  |.|.| |..
plant   242 PEVLTRKGYDA--AKADVWSCGVILFVLMAGHIPFYDKNIMVMYKKIYKGEFRC--PRWFS-SDL 301

  Fly   414 AKLLINQMLIVDPERRPSIDDVLQSSWLRDAPMLQKAKRLMKLDGMEIEEENFLEPPTKRSR 475
            .:|| .::|..:|:.|.:|.:::::.|.:..  .:..|..::.|.:..|:|:..|..:...|
plant   302 VRLL-TRLLDTNPDTRITIPEIMKNRWFKKG--FKHVKFYIEDDKLCREDEDEEEEASSSGR 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 92/278 (33%)
S_TKc 174..441 CDD:214567 92/271 (34%)
CIPK18NP_174217.1 PKc_like 73..327 CDD:419665 92/271 (34%)
CIPK_C 388..499 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1313
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.