DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CIPK9

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_849571.1 Gene:CIPK9 / 839349 AraportID:AT1G01140 Length:451 Species:Arabidopsis thaliana


Alignment Length:272 Identity:101/272 - (37%)
Similarity:155/272 - (56%) Gaps:18/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHP 238
            |.:.|.||.|::..|:...:|.|..|.|:||:.:..:      ......:::..|...||.:.||
plant    19 YEMGRTLGEGSFAKVKYAKNTVTGDQAAIKILDREKV------FRHKMVEQLKREISTMKLIKHP 77

  Fly   239 CVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303
            .||.:.:::.....:|:|||.:.||:|.::|.....|.||.::.||.|:.:||.|.|.||:.|||
plant    78 NVVEIIEVMASKTKIYIVLELVNGGELFDKIAQQGRLKEDEARRYFQQLINAVDYCHSRGVYHRD 142

  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKF---VQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVD 365
            |||:|::|:.|.   :|||||||||.|   |::|.::.|.||||.|||||||...|.:.  ...|
plant   143 LKPENLILDANG---VLKVSDFGLSAFSRQVREDGLLHTACGTPNYVAPEVLSDKGYDG--AAAD 202

  Fly   366 IWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRP 430
            :||.||:||..::|.|||.:.......::|.|..|:.  |.|  .||.||.:|.::|..:|..|.
plant   203 VWSCGVILFVLMAGYLPFDEPNLMTLYKRICKAEFSC--PPW--FSQGAKRVIKRILEPNPITRI 263

  Fly   431 SIDDVLQSSWLR 442
            ||.::|:..|.:
plant   264 SIAELLEDEWFK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 100/269 (37%)
S_TKc 174..441 CDD:214567 100/269 (37%)
CIPK9NP_849571.1 S_TKc 19..274 CDD:214567 100/269 (37%)
STKc_SnRK3 19..273 CDD:271133 100/268 (37%)
CIPK_C 318..437 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.