DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CIPK19

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_199393.1 Gene:CIPK19 / 834621 AraportID:AT5G45810 Length:483 Species:Arabidopsis thaliana


Alignment Length:274 Identity:101/274 - (36%)
Similarity:160/274 - (58%) Gaps:23/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKN--MLSGARPSTNFSDPDRVLNEAKIMKNLS 236
            |.:.|.||.|.:..|.|..:.::.:..|:|::.|.  :.||...        .:..|..|::.:.
plant    28 YEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIA--------HIKREISILRRVR 84

  Fly   237 HPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITH 301
            ||.:|::.:::.....:|.|:|:::||:|.|::...: |.|::::.||.|:..||.:.|.||:.|
plant    85 HPNIVQLFEVMATKSKIYFVMEYVKGGELFNKVAKGR-LKEEMARKYFQQLISAVSFCHFRGVYH 148

  Fly   302 RDLKPDNVLLETNDEETLLKVSDFGLSKF---VQKDSVMRTLCGTPLYVAPEVLITGGREAYTKK 363
            |||||:|:||   ||...|||||||||..   :::|.:..|.||||.|||||||...|.:.  .|
plant   149 RDLKPENLLL---DENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDG--AK 208

  Fly   364 VDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPER 428
            |||||.||:||..::|.|||.|.......::|.:|.|..  |.|..| :..:||| :||...|||
plant   209 VDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRC--PRWFPV-EINRLLI-RMLETKPER 269

  Fly   429 RPSIDDVLQSSWLR 442
            |.::.|::::||.:
plant   270 RFTMPDIMETSWFK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 100/271 (37%)
S_TKc 174..441 CDD:214567 100/271 (37%)
CIPK19NP_199393.1 STKc_SnRK3 27..281 CDD:271133 99/270 (37%)
CIPK_C 346..458 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1313
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.