DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and SR1

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_195802.1 Gene:SR1 / 831765 AraportID:AT5G01820 Length:442 Species:Arabidopsis thaliana


Alignment Length:272 Identity:104/272 - (38%)
Similarity:153/272 - (56%) Gaps:19/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHP 238
            |.|.:.:|.||:..|.....|.|.|..|:|:|.|..|.....:.|      :..|..||..|.||
plant    22 YEVGKLVGCGAFAKVYHGRSTATGQSVAIKVVSKQRLQKGGLNGN------IQREIAIMHRLRHP 80

  Fly   239 CVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303
            .:||:.:::.....::.|:||.:||:|..: :|.....||:|:.||.|:..||.|.|.|||.|||
plant    81 SIVRLFEVLATKSKIFFVMEFAKGGELFAK-VSKGRFCEDLSRRYFQQLISAVGYCHSRGIFHRD 144

  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKF---VQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVD 365
            |||:|:||   ||:..||:||||||..   ::.|.::.||||||.|||||||...|.:.  .|:|
plant   145 LKPENLLL---DEKLDLKISDFGLSALTDQIRPDGLLHTLCGTPAYVAPEVLAKKGYDG--AKID 204

  Fly   366 IWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRP 430
            |||.|::||...:|.|||:|.......::|.||.|..  |.|.|...|.  |:.::|..:|:.|.
plant   205 IWSCGIILFVLNAGYLPFNDHNLMVMYRKIYKGEFRI--PKWTSPDLRR--LLTRLLDTNPQTRI 265

  Fly   431 SIDDVLQSSWLR 442
            :|::::...|.:
plant   266 TIEEIIHDPWFK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 103/269 (38%)
S_TKc 174..441 CDD:214567 103/269 (38%)
SR1NP_195802.1 PKc_like 21..275 CDD:304357 103/268 (38%)
S_TKc 22..276 CDD:214567 103/269 (38%)
CIPK_C 311..419 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1313
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101842
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.