DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CPK17

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_196779.1 Gene:CPK17 / 831091 AraportID:AT5G12180 Length:528 Species:Arabidopsis thaliana


Alignment Length:353 Identity:109/353 - (30%)
Similarity:168/353 - (47%) Gaps:40/353 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 QDLSRNGTFVNNEKIGTNRMRILKNDDVISLSHPTYKAFV--FKDLSPNES-----------IGL 166
            :|.:.||..:.|....:|         ..:.:.||.:|.|  .|...|:..           :|.
plant     9 RDSADNGDALENGASASN---------AANSTGPTAEASVPQSKHAPPSPPPATKQGPIGPVLGR 64

  Fly   167 P-EEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAK 230
            | |::..:|.:.::||.|.:|:..|.....|..|||.|.:.|..|      .|..|.:.|..|.:
plant    65 PMEDVKASYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKL------VNKEDIEDVRREVQ 123

  Fly   231 IMKNLS-HPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYL 294
            ||.:|: .|.:|.:....:...||::|:|...||:|.:|||:....||..:......:...|...
plant   124 IMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTIVQIVHTC 188

  Fly   295 HDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREA 359
            |..|:.||||||:|.||...||.:.||.:|||||.|.:...|.:.:.|:..|:|||||    :..
plant   189 HSMGVIHRDLKPENFLLLNKDENSPLKATDFGLSVFYKPGEVFKDIVGSAYYIAPEVL----KRK 249

  Fly   360 YTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIV 424
            |..:.||||:||:|:..|.|..||..|........|.:|...:....|.|:|.:||.|:.:||..
plant   250 YGPEADIWSIGVMLYILLCGVPPFWAESENGIFNAILRGHVDFSSDPWPSISPQAKDLVKKMLNS 314

  Fly   425 DPERRPSIDDVLQSSWLR------DAPM 446
            ||::|.:...||...|::      |.|:
plant   315 DPKQRLTAAQVLNHPWIKEDGEAPDVPL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 9/42 (21%)
STKc_Chk2 167..441 CDD:270986 94/275 (34%)
S_TKc 174..441 CDD:214567 92/267 (34%)
CPK17NP_196779.1 STKc_CAMK 73..330 CDD:270687 92/266 (35%)
PTZ00184 371..510 CDD:185504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.