DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CIPK2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_196324.1 Gene:CIPK2 / 830598 AraportID:AT5G07070 Length:456 Species:Arabidopsis thaliana


Alignment Length:324 Identity:115/324 - (35%)
Similarity:172/324 - (53%) Gaps:39/324 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 PEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKI 231
            |..:.:.|.|.|.||.|.:..|.......|.:..|:|::.|:.:.....|      .::..|..:
plant     5 PSVLTERYEVGRLLGQGTFAKVYFGRSNHTNESVAIKMIDKDKVMRVGLS------QQIKREISV 63

  Fly   232 MKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHD 296
            |:...||.||.:::::.....:|.|:|:.:||:|.|::...| |.||::..||||:..||.:.|.
plant    64 MRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGK-LKEDVAWKYFYQLISAVDFCHS 127

  Fly   297 RGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFV---QKDSVMRTLCGTPLYVAPEVLITGGRE 358
            ||:.|||:||:|:||:.||.   |||||||||...   ::|.::.|.||||.||||||:...|.|
plant   128 RGVYHRDIKPENLLLDDNDN---LKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYE 189

  Fly   359 AYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKK-GRFAYGHPSWKSVSQRAKLLINQML 422
            .  .|.||||.|||||..|:|.|||.|   |...:..:| |:..:..|||  .:...|.|:.:||
plant   190 G--TKADIWSCGVVLFVLLAGYLPFHD---TNLMEMYRKIGKADFKCPSW--FAPEVKRLLCKML 247

  Fly   423 IVDPERRPSIDDVLQSSWLRDAPMLQKAKRLMKLDGMEIEE----------------ENFLEPP 470
            ..:.|.|.:|..:.:|||.|....| |.|::.|::..::.|                ||. |||
plant   248 DPNHETRITIAKIKESSWFRKGLHL-KQKKMEKMEKQQVREATNPMEAGGSGQNENGENH-EPP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 103/277 (37%)
S_TKc 174..441 CDD:214567 102/270 (38%)
CIPK2NP_196324.1 PKc_like 11..265 CDD:419665 101/270 (37%)
CIPK_C 315..428 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.