DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CRK29

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_193872.2 Gene:CRK29 / 827893 AraportID:AT4G21410 Length:679 Species:Arabidopsis thaliana


Alignment Length:248 Identity:63/248 - (25%)
Similarity:108/248 - (43%) Gaps:51/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DLSPNESIGLPEEINKT----YYVNRKLGSGAYGLV-RLVYDTRTCQQFAMKIVKKNMLSGARPS 216
            :.|..||:.:..|..||    :....:||.|.:|.| :.|:...  |:.|:|.:..|...|    
plant   336 EFSNTESLLVHFETLKTATDNFSSENELGRGGFGSVYKGVFPQG--QEIAVKRLSGNSGQG---- 394

  Fly   217 TNFSDPDRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGG------------DLLNRI 269
                 .:...||..::..|.|..:||:.....:.:...:|.||::..            .||:.:
plant   395 -----DNEFKNEILLLAKLQHRNLVRLIGFCIQGEERLLVYEFIKNASLDQFIFDTEKRQLLDWV 454

  Fly   270 ISNKLLSEDISKLYFYQMCHAVKYLHDRG---ITHRDLKPDNVLLETNDEETLLKVSDFGLSKFV 331
            :..|::.         .:...:.|||:..   |.|||||..|:||   |:|...|::||||:|..
plant   455 VRYKMIG---------GIARGLLYLHEDSRFRIIHRDLKASNILL---DQEMNPKIADFGLAKLF 507

  Fly   332 QKDSVM-----RTLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSG 379
            .....|     ..:.||..|:|||..:.|   .::.|.|::|.||::...::|
plant   508 DSGQTMTHRFTSRIAGTYGYMAPEYAMHG---QFSVKTDVFSFGVLVIEIITG 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 60/238 (25%)
S_TKc 174..441 CDD:214567 57/227 (25%)
CRK29NP_193872.2 Stress-antifung 38..130 CDD:366744
Stress-antifung 159..245 CDD:366744
STKc_IRAK 363..632 CDD:270968 57/221 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.