DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and SIP4

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_180595.1 Gene:SIP4 / 817586 AraportID:AT2G30360 Length:435 Species:Arabidopsis thaliana


Alignment Length:294 Identity:114/294 - (38%)
Similarity:175/294 - (59%) Gaps:22/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHP 238
            |.:.:.||.||:..|....|.||.|..|:||:.|..|     .||.:..:.:..|..||:.||||
plant    21 YELGKLLGCGAFAKVFHARDRRTGQSVAVKILNKKKL-----LTNPALANNIKREISIMRRLSHP 80

  Fly   239 CVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303
            .:|::|:::.....::..:||::||:|.|:|..:..||||:|:.||.|:..||.|.|.||:.|||
plant    81 NIVKLHEVMATKSKIFFAMEFVKGGELFNKISKHGRLSEDLSRRYFQQLISAVGYCHARGVYHRD 145

  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKF---VQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVD 365
            |||:|:|:   ||...|||||||||..   ::.|.::.||||||.|||||:|...|.|.  .|||
plant   146 LKPENLLI---DENGNLKVSDFGLSALTDQIRPDGLLHTLCGTPAYVAPEILSKKGYEG--AKVD 205

  Fly   366 IWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRP 430
            :||.|:|||..::|.|||:|.......::|.||.:.:  |.|  :|...|..::::|.::||.|.
plant   206 VWSCGIVLFVLVAGYLPFNDPNVMNMYKKIYKGEYRF--PRW--MSPDLKRFVSRLLDINPETRI 266

  Fly   431 SIDDVLQSSWLRDAPMLQKAKRLMKLDGMEIEEE 464
            :||::|:..|     .::...:.:|....|||::
plant   267 TIDEILKDPW-----FVRGGFKQIKFHDDEIEDQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 109/269 (41%)
S_TKc 174..441 CDD:214567 109/269 (41%)
SIP4NP_180595.1 PKc_like 20..276 CDD:419665 109/268 (41%)
CIPK_C 308..421 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1313
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101842
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.