DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CAMK2A

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001350918.1 Gene:CAMK2A / 815 HGNCID:1460 Length:489 Species:Homo sapiens


Alignment Length:269 Identity:94/269 - (34%)
Similarity:151/269 - (56%) Gaps:11/269 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHP 238
            |.:..:||.||:.:||........|::|.||:....|| ||      |..::..||:|.:.|.||
Human    13 YQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLS-AR------DHQKLEREARICRLLKHP 70

  Fly   239 CVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303
            .:||:||.:.:....|::.:.:.||:|...|::.:..||..:.....|:..||.:.|..|:.|||
Human    71 NIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRD 135

  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKFVQ-KDSVMRTLCGTPLYVAPEVLITGGREAYTKKVDIW 367
            |||:|:||.:..:...:|::||||:..|: :........|||.|::||||   .::.|.|.||:|
Human   136 LKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVL---RKDPYGKPVDLW 197

  Fly   368 SLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSI 432
            :.||:|:..|.|..||.||......||||.|.:.:..|.|.:|:..||.|||:||.::|.:|.:.
Human   198 ACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITA 262

  Fly   433 DDVLQSSWL 441
            .:.|:..|:
Human   263 AEALKHPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 93/267 (35%)
S_TKc 174..441 CDD:214567 93/267 (35%)
CAMK2ANP_001350918.1 STKc_CaMKII 11..302 CDD:270988 94/269 (35%)
CaMKII_AD 357..484 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.