DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CAMK4

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001310303.1 Gene:CAMK4 / 814 HGNCID:1464 Length:473 Species:Homo sapiens


Alignment Length:301 Identity:100/301 - (33%)
Similarity:164/301 - (54%) Gaps:22/301 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIM 232
            :.::..:.|..:||.||..:|.......|.:.:|:|::||.:           |...|..|..::
Human    40 DALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTV-----------DKKIVRTEIGVL 93

  Fly   233 KNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDR 297
            ..||||.::::.:|.:.|..:.:|||.:.||:|.:||:.....||..:.....|:..||.|||:.
Human    94 LRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHEN 158

  Fly   298 GITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGRE-AYT 361
            ||.||||||:|:|..|...:..||::||||||.|:...:|:|:||||.|.|||:|    |. ||.
Human   159 GIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEIL----RGCAYG 219

  Fly   362 KKVDIWSLGVVLFTCLSGTLPFSDEYGTP-AAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVD 425
            .:||:||:|::.:..|.|..||.||.|.. ..::|....:.:..|.|..||..||.|:.:::::|
Human   220 PEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLD 284

  Fly   426 PERRPSIDDVLQSSWLRDAPMLQKAKRLMKLDGMEIEEENF 466
            |::|.:....||..|:..     ||...:.:|..:.:.:.|
Human   285 PKKRLTTFQALQHPWVTG-----KAANFVHMDTAQKKLQEF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 95/274 (35%)
S_TKc 174..441 CDD:214567 95/268 (35%)
CAMK4NP_001310303.1 STKc_CaMKIV 42..335 CDD:270987 100/299 (33%)
Pkinase 46..300 CDD:278497 95/268 (35%)
Autoinhibitory domain 305..321 2/16 (13%)
PP2A-binding 306..323 2/15 (13%)
Calmodulin-binding. /evidence=ECO:0000255 322..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.