DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and camk2g2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_021336506.1 Gene:camk2g2 / 793359 ZFINID:ZDB-GENE-070323-2 Length:637 Species:Danio rerio


Alignment Length:269 Identity:100/269 - (37%)
Similarity:152/269 - (56%) Gaps:11/269 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHP 238
            |.:..:||.||:.:||......|.|::|.||:....|| ||      |..::..||:|.:.|.||
Zfish    14 YQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLS-AR------DHQKLEREARICRLLKHP 71

  Fly   239 CVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303
            .:||:||.:.:....|:|.:.:.||:|...|::.:..||..:.....|:..:|.::|...|.|||
Zfish    72 NIVRLHDSIAEEGFHYLVFDLVTGGELFEDIVAREYYSESDASHCINQILESVSHIHQHDIVHRD 136

  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKFVQKD-SVMRTLCGTPLYVAPEVLITGGREAYTKKVDIW 367
            |||:|:||.:..:...:|::||||:..||.| .......|||.|::||||   .::.|.|.||||
Zfish   137 LKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL---RKDPYGKPVDIW 198

  Fly   368 SLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSI 432
            :.||:|:..|.|..||.||......||||.|.:.:..|.|.:|:..||.||||||.::|.:|.:.
Zfish   199 ACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITA 263

  Fly   433 DDVLQSSWL 441
            |..|:..|:
Zfish   264 DQALKHPWV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 99/267 (37%)
S_TKc 174..441 CDD:214567 99/267 (37%)
camk2g2XP_021336506.1 STKc_CaMKII 12..303 CDD:270988 100/269 (37%)
CaMKII_AD 505..632 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.