DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and nek11

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001072436.1 Gene:nek11 / 779890 XenbaseID:XB-GENE-955651 Length:601 Species:Xenopus tropicalis


Alignment Length:304 Identity:92/304 - (30%)
Similarity:153/304 - (50%) Gaps:30/304 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 INKTYYVNRKLGSGAYGLVRLVYDTRT-CQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMK 233
            |.|.|.:.::||.|::|.|.||.|.:. .:|.::|::|:..:....|    ::..:...||:::.
 Frog    24 IAKRYLLQQRLGKGSFGTVYLVIDKKAKDEQESLKVLKEIPVGELNP----NETVQANVEAQLLS 84

  Fly   234 NLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISK----LYFYQMCHAVKYL 294
            .|.||.:|:.|....:.:|..::.|:..|.||..::...|...|.|::    .:|.|:...|.|:
 Frog    85 KLDHPAIVKFHASFLENESFCIITEYCEGRDLDFKVRECKKNEEKIAENQVVEWFIQLLLGVNYM 149

  Fly   295 HDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKD-SVMRTLCGTPLYVAPEVLITGGRE 358
            |.|.|.|||||..|:.|:.|    |||:.|||:|:.:... .:..|..|||.|::||.|   ..:
 Frog   150 HVRRILHRDLKAKNIFLKNN----LLKIGDFGVSRLLMGSCDLATTFTGTPYYMSPEAL---KHQ 207

  Fly   359 AYTKKVDIWSLGVVL--FTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKS-VSQRAKLLINQ 420
            .|..|.||||||.:|  ..||...  |...........|.:|.    .||... .|....|::|:
 Frog   208 GYDSKSDIWSLGCILHEMCCLEHA--FIGYNFLSVVISIVEGE----TPSLPDCYSSSLNLIMNR 266

  Fly   421 MLIVDPERRPSIDDVLQSSWLRDAPMLQKAKRLMKLDGMEIEEE 464
            ||..||..|||..::||..::.:  .|::.|  .::.|.|::::
 Frog   267 MLNKDPALRPSAGEILQDPFINE--QLKQVK--WEVYGAEVKDK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 88/279 (32%)
S_TKc 174..441 CDD:214567 86/275 (31%)
nek11NP_001072436.1 STKc_Nek11 27..287 CDD:270861 86/276 (31%)
S_TKc 28..287 CDD:214567 86/275 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.