DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Stk33

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_008758045.2 Gene:Stk33 / 690861 RGDID:1590972 Length:508 Species:Rattus norvegicus


Alignment Length:284 Identity:94/284 - (33%)
Similarity:151/284 - (53%) Gaps:25/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 INKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVL-NEAKIMK 233
            |.:.|...|.||.|::|:|....|..|..::|:|.|.|....        |...::| .|..|:|
  Rat   108 IEEFYTFGRILGQGSFGMVIEATDKETGAKWAIKKVNKEKAG--------SSAVKLLEREVNILK 164

  Fly   234 NLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRG 298
            .:.|..::.:..:.:.|..:|:|:|....|:|...:......||..::|....:..|:.|||.:.
  Rat   165 TVKHQHIIHLEQVFESPQKMYLVMELCEDGELKEVLDQRGHFSESETRLIIQSLASAIAYLHSKD 229

  Fly   299 ITHRDLKPDNVL-----LETNDEETL-LKVSDFGLSKFVQK-----DSVMRTLCGTPLYVAPEVL 352
            |.|||||.:|::     ::.|:|..| :|||||||:  |||     :|:|:|.||||:|:||||:
  Rat   230 IVHRDLKLENIMVKSSFIDDNNEMNLNIKVSDFGLA--VQKHGSRSESMMQTTCGTPIYMAPEVI 292

  Fly   353 ITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLL 417
               ....|:::.||||:||:::..|.|..||.........:.|:||...:..|.|.|||..||..
  Rat   293 ---NAHDYSQQCDIWSIGVIMYILLCGEPPFLANSEEKLFELIRKGELQFQDPVWDSVSDSAKSA 354

  Fly   418 INQMLIVDPERRPSIDDVLQSSWL 441
            :.|::.|||..|.:..::|.:.||
  Rat   355 LKQLMKVDPAHRITAKELLDNQWL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 92/282 (33%)
S_TKc 174..441 CDD:214567 91/278 (33%)
Stk33XP_008758045.2 PKc_like 110..378 CDD:419665 91/280 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44167
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.