DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and STK4

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_005260587.1 Gene:STK4 / 6789 HGNCID:11408 Length:503 Species:Homo sapiens


Alignment Length:346 Identity:94/346 - (27%)
Similarity:153/346 - (44%) Gaps:36/346 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 TFVNNEKIGTNRMRILKNDDVISLSHPTYKAFVFKDLSPNESIGLPEEINKTYYVNRKLGSGAYG 186
            :|:.:.:...|.:.||     :|.|.|.. ....|.|..:.....|||:   :.|..|||.|:||
Human     3 SFITDVQCLPNGLHIL-----LSSSEPDI-GRQLKKLDEDSLTKQPEEV---FDVLEKLGEGSYG 58

  Fly   187 LVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHPCVVRMHDIVDKPD 251
            .|.......|.|..|:|.|...           ||...::.|..||:....|.||:.:....|..
Human    59 SVYKAIHKETGQIVAIKQVPVE-----------SDLQEIIKEISIMQQCDSPHVVKYYGSYFKNT 112

  Fly   252 SVYMVLEFMRGGDLLNRI-ISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETND 315
            .:::|:|:...|.:.:.| :.||.|:||............::|||.....|||:|..|:||.|  
Human   113 DLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNT-- 175

  Fly   316 EETLLKVSDFGLSKFVQKDSVMR-TLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSG 379
             |...|::|||::..:......| |:.|||.::||||:...|   |....||||||:.......|
Human   176 -EGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIG---YNCVADIWSLGITAIEMAEG 236

  Fly   380 TLPFSDEYGTPAAQQIKKGRFAYGHPSWKSV---SQRAKLLINQMLIVDPERRPSIDDVLQSSWL 441
            ..|::|.:...|...|...    ..|:::..   |......:.|.|:..||:|.:...:||..::
Human   237 KPPYADIHPMRAIFMIPTN----PPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFV 297

  Fly   442 RDAPMLQKAKRLMKLDGMEIE 462
            |.|..:...:.|:. :.|:::
Human   298 RSAKGVSILRDLIN-EAMDVK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 7/33 (21%)
STKc_Chk2 167..441 CDD:270986 81/278 (29%)
S_TKc 174..441 CDD:214567 78/271 (29%)
STK4XP_005260587.1 STKc_MST1_2 42..297 CDD:132943 81/278 (29%)
S_TKc 46..297 CDD:214567 78/271 (29%)
Mst1_SARAH 449..496 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.