DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and STK3

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_016869245.1 Gene:STK3 / 6788 HGNCID:11406 Length:580 Species:Homo sapiens


Alignment Length:328 Identity:93/328 - (28%)
Similarity:145/328 - (44%) Gaps:42/328 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KDLSPNESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFS 220
            |.||.:.....|||:   :.|..|||.|:||.|.......:.|..|:|.|...           |
Human    97 KKLSEDSLTKQPEEV---FDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVE-----------S 147

  Fly   221 DPDRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRI-ISNKLLSEDISKLYF 284
            |...::.|..||:....|.||:.:....|...:::|:|:...|.:.:.| :.||.|.||......
Human   148 DLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATIL 212

  Fly   285 YQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMR-TLCGTPLYVA 348
            ......::|||.....|||:|..|:||.|   |...|::|||::..:......| |:.|||.::|
Human   213 KSTLKGLEYLHFMRKIHRDIKAGNILLNT---EGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMA 274

  Fly   349 PEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSV--- 410
            |||:...|   |....||||||:.......|..|::|.:...|...|...    ..|:::..   
Human   275 PEVIQEIG---YNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTN----PPPTFRKPELW 332

  Fly   411 SQRAKLLINQMLIVDPERRPSIDDVLQSSWLRDA------------PMLQKAKRLMKLD-GMEIE 462
            |......:.:.|:.:||:|.:...:||..::::|            .|..||||..:.. .:|.|
Human   333 SDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEE 397

  Fly   463 EEN 465
            |||
Human   398 EEN 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 93/328 (28%)
STKc_Chk2 167..441 CDD:270986 79/278 (28%)
S_TKc 174..441 CDD:214567 76/271 (28%)
STK3XP_016869245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.