DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and RYK

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001005861.1 Gene:RYK / 6259 HGNCID:10481 Length:610 Species:Homo sapiens


Alignment Length:358 Identity:74/358 - (20%)
Similarity:137/358 - (38%) Gaps:83/358 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DLSRNGTFVNNEKIGTNRMRILKNDDVISLSHPTYKAFVFKDLS-PNESIGLPEEINKTYYVNRK 179
            |...|.|.:.: .:|...:||.|| |:.|::....|..| ||:: ..|.|.|.:.:.:..:    
Human   287 DTPN
NATPITS-SLGYPTLRIEKN-DLRSVTLLEAKGKV-KDIAISRERITLKDVLQEGTF---- 344

  Fly   180 LGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHPCVVR-- 242
             |...:|::....|....:|..:|.||..                 .:|.::...|:..|.:|  
Human   345 -GRIFHGILIDEKDPNKEKQAFVKTVKDQ-----------------ASEIQVTMMLTESCKLRGL 391

  Fly   243 --------MHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLL---------SEDISKLYFYQMCHA 290
                    .|..:::.:...::|.:|..|:|...:...||:         .:|:..:.....| .
Human   392 HHRNLLPITHVCIEEGEKPMVILPYMNWGNLKLFLRQCKLVEANNPQAISQQDLVHMAIQIAC-G 455

  Fly   291 VKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSK--FVQKDSVMRTLCGTPL-YVAPEVL 352
            :.||..|.:.|:||...|.::   |:...:|::|..||:  |......:......|: ::|.|.|
Human   456 MSYLARREVIHKDLAARNCVI---DDTLQVKITDNALSRDLFPMDYHCLGDNENRPVRWMALESL 517

  Fly   353 ITGGREAYTKKVDIWSLGVVLFTCLS-GTLPFSDEYGTPAAQQIKKG------------RFAYGH 404
            :   ...::...|:|:.||.|:..:: |..|:.|......|..:|.|            .||...
Human   518 V---NNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMA 579

  Fly   405 PSWKSVSQRAKLLINQMLIVDPERRPSIDDVLQ 437
            ..|               .:|||.||....::|
Human   580 CCW---------------ALDPEERPKFQQLVQ 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 12/39 (31%)
STKc_Chk2 167..441 CDD:270986 57/306 (19%)
S_TKc 174..441 CDD:214567 57/299 (19%)
RYKNP_001005861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
WIF 63..196 CDD:128745
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..290 1/2 (50%)
PTK_Ryk 326..606 CDD:270639 60/316 (19%)
Pkinase_Tyr 333..599 CDD:285015 59/309 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.