DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and sbk1

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_688256.4 Gene:sbk1 / 559792 ZFINID:ZDB-GENE-091118-114 Length:400 Species:Danio rerio


Alignment Length:278 Identity:79/278 - (28%)
Similarity:136/278 - (48%) Gaps:25/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 EINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMK 233
            |:.:.:.:...||.|.||.|.||.......:.|:|.|.||       .|....   .|.|..:..
Zfish    48 EVEQQFELISPLGKGTYGKVDLVVHRTQGTKLALKYVSKN-------KTKLRS---FLREYSLNA 102

  Fly   234 NLS-HPCVVRMHDIV-DKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHD 296
            .|. .|.::::.::: :..||.....|:...|||.:.|.....|.|::.|....|:..|:.::|.
Zfish   103 ALGCSPFIIKVLNVLFETEDSYVFGQEYAPAGDLFDIIPPQAGLPEEMVKRCVQQLGLALDFMHS 167

  Fly   297 RGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVL---ITGGRE 358
            :.:.|||:||:|||| .:.|...:|::|.|:::  :..|.::.:.||..|.|.||.   ::.|..
Zfish   168 KSLVHRDVKPENVLL-FDRECRRVKLADLGMTR--RSGSRIKRISGTIPYTAAEVCQASVSEGII 229

  Fly   359 AYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPA----AQQIKKGRFAYGH-PS-WKSVSQRAKLL 417
            ..|.: |:|:.||:||..|:|..|:.......|    .|:.::|.|..|. || |:..|..|..:
Zfish   230 VATTQ-DVWAFGVLLFCMLTGNFPWEAALPNDAFFAEFQRWQRGAFPPGSVPSQWRRFSDDALRM 293

  Fly   418 INQMLIVDPERRPSIDDV 435
            ..::|.::||||..:.:|
Zfish   294 FGRLLALEPERRCGVKEV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 79/278 (28%)
S_TKc 174..441 CDD:214567 78/273 (29%)
sbk1XP_688256.4 S_TKc 53..322 CDD:214567 78/273 (29%)
STKc_SBK1 59..319 CDD:270889 78/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.