DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and ulk1b

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_002665971.2 Gene:ulk1b / 558848 ZFINID:ZDB-GENE-071203-2 Length:1011 Species:Danio rerio


Alignment Length:229 Identity:81/229 - (35%)
Similarity:135/229 - (58%) Gaps:29/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EEINKTYYVNRK--LGSGAYGLVRLVYDTRTCQ----QFAMKIV-KKNMLSGARPSTNFSDPDRV 225
            |.:.| :..:||  :|.||:.   :|:..|..:    :.|:|.: |||:   |:..|...     
Zfish     2 ETVGK-FEFSRKDLIGHGAFA---VVFKGRHREKHEWEVAVKCINKKNL---AKSQTLLG----- 54

  Fly   226 LNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHA 290
             .|.||:|.|.|..:|.:||..:...|||:|:|:..||||.:.:.|...||||..:::..|:..|
Zfish    55 -KEIKILKELKHENIVALHDFQETASSVYLVMEYCNGGDLADYLHSKGTLSEDTIRVFLQQITGA 118

  Fly   291 VKYLHDRGITHRDLKPDNVLL------ETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAP 349
            ::.|..:||.||||||.|:||      :::...|.:|::|||.::::|.:.:..||||:|:|:||
Zfish   119 MRVLQAKGIIHRDLKPQNILLSHPAGRKSHFNNTCIKIADFGFARYLQNNMMAATLCGSPMYMAP 183

  Fly   350 EVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPF 383
            ||:::   :.|..|.|:||:|.::|.||:|..||
Zfish   184 EVIMS---QNYDAKADLWSIGTIVFQCLTGKAPF 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 81/229 (35%)
S_TKc 174..441 CDD:214567 79/223 (35%)
ulk1bXP_002665971.2 PKc_like 6..272 CDD:304357 80/225 (36%)
S_TKc 9..271 CDD:214567 79/221 (36%)
DUF3543 796..1007 CDD:288883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.