DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and camkk1a

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_005171905.1 Gene:camkk1a / 541526 ZFINID:ZDB-GENE-050327-62 Length:497 Species:Danio rerio


Alignment Length:376 Identity:105/376 - (27%)
Similarity:188/376 - (50%) Gaps:71/376 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LSRNGTFVNNE-----KIGTNRMRILKNDDVISLSHPTYKAFVFKDLSPNESIGLPEEINKTYYV 176
            |...||::::.     .|.:.|:.|..:.|.|.|:.                          |.:
Zfish    67 LQERGTYMSSRIARQPTIESKRVSISDSQDCIQLNQ--------------------------YKL 105

  Fly   177 NRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNML------------------SGARPSTNFSDPD 223
            ..::|.|:||:|:|.|:....:.:|||:|.|..|                  .|.:|.. ....:
Zfish   106 KSEIGKGSYGVVKLAYNEDDDKYYAMKVVSKKKLMKQYGFPRRPPPRGPKAAQGEQPKV-LGPLE 169

  Fly   224 RVLNEAKIMKNLSHPCVVRMHDIVDKP--DSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQ 286
            ||..|..|:|.|.|..:|::.:::|.|  |:::||.|.|:.|.:: .:.|:...|||.::.||..
Zfish   170 RVYQEIAILKKLDHLNIVKLVEVLDDPAEDNLHMVFELMQKGPVM-EVPSDSPFSEDQARHYFRD 233

  Fly   287 MCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLS-KFVQKDSVMRTLCGTPLYVAPE 350
            :...::|||.:.|.|||:||.|:||   .::..:|::|||:| :|...|:::.:..|||.::|||
Zfish   234 IVLGIEYLHYQKIVHRDIKPSNLLL---GDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPE 295

  Fly   351 VLITGGREAYT-KKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRA 414
            .| :..|:::: |.:|:|::||.|:..:.|..||.|||......:||.....:  |...:||:..
Zfish   296 TL-SDNRQSFSGKALDVWAMGVTLYCFVYGKCPFIDEYILALHNKIKSKVVEF--PDTPTVSEGL 357

  Fly   415 KLLINQMLIVDPERRPSIDDVLQSSWLRDAPMLQKAKRLMKLDGMEIEEEN 465
            |.|:::||..:|:.|.:|.::....|     :.|..|     |.:.:|||:
Zfish   358 KSLVSRMLDKNPDTRITIPEIKVDPW-----VTQDGK-----DPLPLEEEH 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 9/43 (21%)
STKc_Chk2 167..441 CDD:270986 89/295 (30%)
S_TKc 174..441 CDD:214567 89/288 (31%)
camkk1aXP_005171905.1 STKc_CaMKK1 102..385 CDD:271102 90/321 (28%)
S_TKc 103..384 CDD:214567 90/293 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.