DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CG10177

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:338 Identity:87/338 - (25%)
Similarity:151/338 - (44%) Gaps:72/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 KNDDVISLSHPTYKAFV---------------FKDLSPNESIGLPEEINKTYYVNRKLGSGAYGL 187
            ||:::|.:.:...|.|.               ...|...:|..|||.|.  .|:..        :
  Fly    98 KNEEIICVKYS
INKDFQRMVDSCKRWGQHHLDSGTLESMKSHDLPEAIQ--LYIET--------I 152

  Fly   188 VRLVYDTRTC----------QQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNL-SHPCVV 241
            ..:.::|||.          .:..:|:|.|...|..|..|..        ||::::.| |||.::
  Fly   153 EPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYM--------EAEVLRQLQSHPNII 209

  Fly   242 RMHDIVDKPDSVYMVLEFMRGGDLLNRIISNK-LLSEDISKLYFYQMCHAVKYLHDRGITHRDLK 305
            .:...|:....:|.|||.:...  :.::|..: :|||..::........|:.::|...:.|||:|
  Fly   210 ELMYTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIK 272

  Fly   306 PDNVLLETNDEE---TLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVDIW 367
            |:|:|:.::..:   .::||::|.|:.: .:.|.:...||||.|:|||::...|   |..:||.|
  Fly   273 PENLLVCSSSGKWNFKMVKVANFDLATY-YRGSKLYVRCGTPCYMAPEMIAMSG---YDYQVDSW 333

  Fly   368 SLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAY-----GHPSWKS-----VSQRAKLLINQML 422
            ||||.||..|.|.:||        |...|..:..|     |.|::..     :|..|..||:.:|
  Fly   334 SLGVTLFYMLCGKMPF--------ASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLL 390

  Fly   423 IVDPERRPSIDDV 435
            :.||..|..|.::
  Fly   391 VSDPSYRVPIAEL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 5/32 (16%)
STKc_Chk2 167..441 CDD:270986 79/294 (27%)
S_TKc 174..441 CDD:214567 76/287 (26%)
CG10177NP_651150.1 DCX 18..108 CDD:214711 3/9 (33%)
S_TKc 164..409 CDD:214567 72/262 (27%)
PKc_like 164..403 CDD:304357 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.