DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Lkb1

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster


Alignment Length:449 Identity:117/449 - (26%)
Similarity:190/449 - (42%) Gaps:94/449 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ESQPMEKIVWGRLYGKNIKIKSLGTSSKYRIIYTHSSFSVDLNNDEFT-------------AGRG 74
            |..|:|..:...|..||.                |...:.||::|.|.             ||.|
  Fly    61 EPDPVEDEMTVLLANKNF----------------HYDVASDLDDDAFVELKEDTAQADDAGAGVG 109

  Fly    75 EANDLILTLNDLPEKILTRISKVHF-IIKRANCELTNPVYIQDLSRNGTFVNNEKIGTNRMRILK 138
            ..|...|.|:|.|...:|.:..... .:.|...::.|..:                  ||   :.
  Fly   110 FYNPDELLLDDQPHPQVTWLDDDEIETLDRVTLDMGNMFF------------------NR---VD 153

  Fly   139 NDDVISLSHPTYKAFVFKDLSPNESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMK 203
            :.|:|      |:       ...:||.:   :.| |.:...||.|:||.|:...::....:.|:|
  Fly   154 SQDII------YQ-------QKKKSIKM---VGK-YIMGDVLGEGSYGKVKEAMNSENLCRLAVK 201

  Fly   204 IVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHPCVVRMHDIV--DKPDSVYMVLEFMRGGDLL 266
            |:.|..|   |...|  ....|..|..::|.|.|..||.:.|::  ::...:|:|:|:..||  |
  Fly   202 ILTKRKL---RRIPN--GEQNVTREIALLKQLKHRHVVELVDVLYNEEKQKMYLVMEYCVGG--L 259

  Fly   267 NRIIS---NKLLSEDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLS 328
            ..:|.   :|.:....:..||.|:...::|||...:.|:|:||.|:||..   :..||:||||::
  Fly   260 QEMIDYQPDKRMPLFQAHGYFKQLVDGLEYLHSCRVIHKDIKPGNLLLSL---DQTLKISDFGVA 321

  Fly   329 K---FVQKDSVMRTLCGTPLYVAPEVLITGGREAYTK-KVDIWSLGVVLFTCLSGTLPFSDEYGT 389
            :   ....|....|..|:|.:..||  |..|.|.:.. ||||||.||.|:...:|..||..:...
  Fly   322 EQLDLFAPDDTCTTGQGSPAFQPPE--IANGHETFAGFKVDIWSSGVTLYNLATGQYPFEGDNIY 384

  Fly   390 PAAQQIKKGRFAYGHPSW--KSVSQRAKLLINQMLIVDPERRPSIDDVLQSSWLRDAPM 446
            ...:.|  ||..:..|:|  :..:..|.|::. ||..||.:|.|:.::...:|.|.||:
  Fly   385 RLLENI--GRGQWEAPAWLYEMDADFANLILG-MLQADPSKRLSLQEIRHDTWFRSAPV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 22/130 (17%)
STKc_Chk2 167..441 CDD:270986 84/284 (30%)
S_TKc 174..441 CDD:214567 83/277 (30%)
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 83/277 (30%)
STKc_LKB1 178..435 CDD:271021 82/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.