DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Aduk

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster


Alignment Length:303 Identity:89/303 - (29%)
Similarity:150/303 - (49%) Gaps:22/303 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQ---FAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNL 235
            :.:..|||:|:|.   .||..|..:|   .|:|.|:.:.||.       :..:.::.|.::::.|
  Fly     9 FEILEKLGAGSYA---TVYKARHKKQRTYHAIKYVEMSTLSQ-------TSRENLITEIRLLREL 63

  Fly   236 SHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGIT 300
            .|..:|.:.|......::|:|||:...|:|...|.:.|.|.|...:.:..|:..||:|:....::
  Fly    64 KHKYIVTLQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVS 128

  Fly   301 HRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVD 365
            |.||||.|:||........|||:|||.::.::...:.:.|.|:|||:|||::   .:..|..|.|
  Fly   129 HFDLKPQNLLLTRGANNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIV---RKHQYDAKAD 190

  Fly   366 IWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRP 430
            :||:||:|:.||.|..|:|.........:|:|.. |...|....:|.....|:.::|..:|..|.
  Fly   191 LWSIGVILYECLFGKAPYSSRTIEELLLRIRKAE-AITLPPNARISNECHDLLRRLLAHEPTARI 254

  Fly   431 SIDDVLQSSW--LRDAP---MLQKAKRLMKLDGMEIEEENFLE 468
            |..|.....:  |:..|   .||||..|:.......|:.|:.|
  Fly   255 SFADFFAHPFLDLKTFPTEHTLQKAIDLVTQACAYDEKHNYKE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 79/271 (29%)
S_TKc 174..441 CDD:214567 79/271 (29%)
AdukNP_731331.1 S_TKc 9..265 CDD:214567 79/269 (29%)
PKc_like 13..264 CDD:304357 79/264 (30%)
MIT_2 274..348 CDD:239147 8/24 (33%)
MIT 407..472 CDD:282117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.