DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and 4921509C19Rik

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_941057.1 Gene:4921509C19Rik / 381393 MGIID:2685851 Length:640 Species:Mus musculus


Alignment Length:292 Identity:98/292 - (33%)
Similarity:154/292 - (52%) Gaps:32/292 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KDLSPN--ESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIV---KKNMLSGARP 215
            :||..|  |...|.|.    |.:...||.|.:|.|:|.....|..:.|:||:   :||.|     
Mouse     8 QDLRSNTFEDAALTEH----YEILTTLGQGTFGEVKLASHLVTQTKVAIKILPKSRKNSL----- 63

  Fly   216 STNFSDPDRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDIS 280
                     |..|.:|||:|.||.::::..|:|...::::|||...||:|::||.....|:|...
Mouse    64 ---------VQPEIEIMKSLDHPHIIKLLHIIDTTRNIFIVLEHAVGGELMSRIEEFGYLAEVEC 119

  Fly   281 KLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPL 345
            ...|.|:.:|::|.|::||.||||||:|:||   |....:|::||||...:.....:.|.|||..
Mouse   120 HRLFKQLVYALQYCHEKGIVHRDLKPENILL---DHRGNVKLTDFGLGTKIIMGQKLVTFCGTLP 181

  Fly   346 YVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSV 410
            |.|||:....|.:.  :..|:|||||||:...:|.|||:........|:|..|::    |...|:
Mouse   182 YCAPELFEDRGYDG--RATDVWSLGVVLYFMATGCLPFNGYSYEAIKQKIIAGKY----PRSFSL 240

  Fly   411 SQRAKLLINQMLIVDPERRPSIDDVLQSSWLR 442
            |.....:|.::|.|:|..||::.|:.:..||:
Mouse   241 SPELWEVIAKLLTVNPGERPTVHDIARFKWLK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 98/292 (34%)
STKc_Chk2 167..441 CDD:270986 91/276 (33%)
S_TKc 174..441 CDD:214567 90/269 (33%)
4921509C19RikNP_941057.1 STKc_AMPK-like 23..270 CDD:270905 90/273 (33%)
UBA_MARK_Par1 290..328 CDD:270522
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 464..509
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..576
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 617..640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.