DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and camk1ga

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_956260.1 Gene:camk1ga / 335654 ZFINID:ZDB-GENE-030131-7594 Length:426 Species:Danio rerio


Alignment Length:272 Identity:98/272 - (36%)
Similarity:148/272 - (54%) Gaps:14/272 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 INKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKN 234
            |.:.:.....||||::..|.||.:.::...:|:|.|||..|..:          .:.||.:::|.
Zfish    17 IKEIFDFKEVLGSGSFSEVYLVRERKSGNFYALKCVKKKQLHHS----------NLENEIQVLKR 71

  Fly   235 LSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGI 299
            :.|..||.:.|..:.....|:|:|.:.||:|.:||:...:.:|..:.....|:..||.|||...|
Zfish    72 IKHSNVVGLEDFYESRTHYYLVMELVSGGELFDRILDRGVYTEKDASRVINQVLEAVSYLHQNSI 136

  Fly   300 THRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKV 364
            .||||||:|:|..:.||...:.:||||||| :....||.|.||||.|||||||   .::.|:|.|
Zfish   137 VHRDLKPENLLYYSPDENAKIMISDFGLSK-MSDHGVMSTACGTPGYVAPEVL---AQKPYSKAV 197

  Fly   365 DIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERR 429
            |.||:||:.:..|||..||.:|..|....:|.|..:|:..|.|..:|:.||..|..||..:|.:|
Zfish   198 DCWSIGVITYILLSGYPPFYEENETRLFSKIMKAEYAFHSPYWDDISESAKDFIRHMLEKNPSKR 262

  Fly   430 PSIDDVLQSSWL 441
            .:.:..|...|:
Zfish   263 YTTEQALSHPWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 97/270 (36%)
S_TKc 174..441 CDD:214567 96/266 (36%)
camk1gaNP_956260.1 STKc_CaMKI_gamma 17..300 CDD:271068 98/272 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.