DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CG17528

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster


Alignment Length:279 Identity:94/279 - (33%)
Similarity:155/279 - (55%) Gaps:17/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 LPEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAK 230
            ||..|..||.:.|.:|.|.:.:|..:...:|...:|:||:.||...|   ..::.|.     |.:
  Fly   469 LPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKG---KEHYIDA-----EVR 525

  Fly   231 IMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLH 295
            :||.|:||.::.:...||:..::|:|||::.||||.:.|......||:.|::....:..|:.|||
  Fly   526 VMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLH 590

  Fly   296 DRGITHRDLKPDNVLLETNDEETL--LKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGRE 358
            ..||.|||:||:|:|::.::...:  ||::||||:  .:.:.::..:||||.|||||:|:..|  
  Fly   591 SMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLA--CEVNDLLYAVCGTPTYVAPEILLEVG-- 651

  Fly   359 AYTKKVDIWSLGVVLFTCLSGTLPF--SDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQM 421
             |..|:|:|:.|::|:..|.|..||  .|....|....|..|.:.:..|.|..:....:.||..|
  Fly   652 -YGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANM 715

  Fly   422 LIVDPERRPSIDDVLQSSW 440
            |..||:.|.:.:|:|..||
  Fly   716 LQADPDVRFTSEDILDHSW 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 93/278 (33%)
S_TKc 174..441 CDD:214567 90/271 (33%)
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 88/269 (33%)
S_TKc 477..734 CDD:214567 88/269 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.