DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and PhKgamma

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:158/293 - (53%) Gaps:25/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DLSPNESIGLPEEINKTYYVNRK----LGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPST 217
            ||.|:      ::..|.:|...:    ||.|....||...:..|.::||.||:.    .||...:
  Fly     8 DLLPD------KDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIID----LGATTES 62

  Fly   218 NFSDPDRVL----NEAKIMKN-LSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSE 277
            ..::|..:|    .|..|::. :.||.::.:.|:.:....|::|.|....|:|.:.:.|...|||
  Fly    63 GETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSE 127

  Fly   278 DISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCG 342
            ..::....|:...|:|:|.:.|.||||||:|:||   ||...:|::|||.:|.:|:...:..|||
  Fly   128 KKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCG 189

  Fly   343 TPLYVAPEVL---ITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGH 404
            ||.|:|||.|   :..|...|:::||||:.||::||.|.|..||.........:.|.:|::::..
  Fly   190 TPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTS 254

  Fly   405 PSWKSVSQRAKLLINQMLIVDPERRPSIDDVLQ 437
            |.|..:|:..|.||.:.|:|||.:|.::.:||:
  Fly   255 PEWADISEDPKDLIRKCLVVDPSQRITVKEVLR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 91/283 (32%)
S_TKc 174..441 CDD:214567 90/276 (33%)
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 90/276 (33%)
S_TKc 23..291 CDD:214567 89/272 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44167
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.