DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Dclk3

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001178729.1 Gene:Dclk3 / 316023 RGDID:1309232 Length:807 Species:Rattus norvegicus


Alignment Length:280 Identity:99/280 - (35%)
Similarity:166/280 - (59%) Gaps:24/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 EINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMK 233
            ::.|.|.:.|.:|.|.:.:|:......|.|.:||||:.|:.|.|..        |.|.:|..|::
  Rat   510 DVEKHYDIGRVIGDGNFAIVKECKHRETRQAYAMKIIDKSQLKGKE--------DIVDSEILIIQ 566

  Fly   234 NLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRG 298
            :||||.:|::|::.:....:|:::|:::||||.:.||.:....|..:.:....:|.|:.::||:.
  Rat   567 SLSHPNIVKLHEVYETEAEIYLIMEYVQGGDLFDAIIESVKFPEPDAAVMITDLCKALVHMHDKK 631

  Fly   299 ITHRDLKPDNVLLETN-DEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTK 362
            |.||||||:|:|::.| |:.|.||::||||:|.|.:.  :.|:||||.|||||:|   ..:.|..
  Rat   632 IVHRDLKPENLLVQRNEDKSTTLKLADFGLAKHVVRP--IFTVCGTPTYVAPEIL---SEKGYGL 691

  Fly   363 KVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQ------IKKGRFAYGHPSWKSVSQRAKLLINQM 421
            :||:|:.||:|:..|.|..||.    :|...|      |:.|:|.:..|.|.::|..||.|:..:
  Rat   692 EVDMWAAGVILYILLCGFPPFR----SPERDQDELFNIIQLGQFEFLSPYWDNISDAAKDLVRNL 752

  Fly   422 LIVDPERRPSIDDVLQSSWL 441
            |:|||::|.:...||...|:
  Rat   753 LVVDPKKRYTAHQVLHHPWI 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 98/278 (35%)
S_TKc 174..441 CDD:214567 97/273 (36%)
Dclk3NP_001178729.1 UBQ 92..177 CDD:294102
PKc_like 514..771 CDD:304357 97/273 (36%)
S_TKc 515..772 CDD:214567 97/273 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101842
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.