DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Prkd3

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001019434.2 Gene:Prkd3 / 313834 RGDID:1310236 Length:890 Species:Rattus norvegicus


Alignment Length:297 Identity:100/297 - (33%)
Similarity:168/297 - (56%) Gaps:22/297 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KDLSPNESIG---LPE--EINKTY--YVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGA 213
            |||:.:.|:.   :.|  :|:..|  :.:..||||.:|:|......:|.:..|:|::.|......
  Rat   551 KDLATSISVSNCQIQENVDISSVYQIFADEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTK 615

  Fly   214 RPSTNFSDPDRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNK--LLS 276
            :.|       ::.||..|::||.||.:|.:..:.:.|:.|::|:|.:. ||:|..|:|::  .|.
  Rat   616 QES-------QLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLH-GDMLEMILSSEKSRLP 672

  Fly   277 EDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLC 341
            |.|:|....|:..|::.||.:.|.|.||||:||||.:.:....:|:.|||.::.:.:.|..|::.
  Rat   673 ERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVV 737

  Fly   342 GTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPS 406
            |||.|:|||||.:.|   |.:.:|:||:||:::..||||.||:::  .....||:...|.|....
  Rat   738 GTPAYLAPEVLRSKG---YNRSLDMWSVGVIVYVSLSGTFPFNED--EDINDQIQNAAFMYPPNP 797

  Fly   407 WKSVSQRAKLLINQMLIVDPERRPSIDDVLQSSWLRD 443
            |:.:|..|..|||.:|.|...:|.|:|..|...||:|
  Rat   798 WREISSEAIDLINNLLQVKMRKRYSVDKSLSHPWLQD 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 100/297 (34%)
STKc_Chk2 167..441 CDD:270986 93/279 (33%)
S_TKc 174..441 CDD:214567 91/270 (34%)
Prkd3NP_001019434.2 C1_PKD3_rpt1 145..219 CDD:410391
C1 267..335 CDD:412127
PH_PKD 410..534 CDD:269945
STKc_PKD 572..831 CDD:270984 91/271 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.