DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Sgk1

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006227785.1 Gene:Sgk1 / 29517 RGDID:3668 Length:525 Species:Rattus norvegicus


Alignment Length:374 Identity:99/374 - (26%)
Similarity:167/374 - (44%) Gaps:66/374 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 SRNGTFVNNEKIGTNR-MRILKNDDVISLSHPTYKAFV---------------FKDLSPNESIGL 166
            |.:..|:...::|.|. ::.|.|:. .:..||..::::               ....||::.|.|
  Rat   116 SDDPAFMKQRRMGLNDFIQKLANNS-YACKHPEVQSYLKISQPQEPELMNANPSPPPSPSQQINL 179

  Fly   167 -----PEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVL 226
                 |......::..:.:|.|::|.|.|.........:|:|:::|..:...:...:......||
  Rat   180 GPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEAFYAVKVLQKKAILKKKEEKHIMSERNVL 244

  Fly   227 NEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAV 291
                 :||:.||.:|.:|......|.:|.||:::.||:|...:...:...|..::.|..::..|:
  Rat   245 -----LKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASAL 304

  Fly   292 KYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSK-FVQKDSVMRTLCGTPLYVAPEVLITG 355
            .|||...|.:|||||:|:||   |.:..:.::||||.| .::.:....|.||||.|:|||||   
  Rat   305 GYLHSLNIVYRDLKPENILL---DSQGHIVLTDFGLCKENIEHNGTTSTFCGTPEYLAPEVL--- 363

  Fly   356 GREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQ 420
            .::.|.:.||.|.||.||:..|.|..||   |....|:....                   ::|:
  Rat   364 HKQPYDRTVDWWCLGAVLYEMLYGLPPF---YSRNTAEMYDN-------------------ILNK 406

  Fly   421 MLIVDPERRPSIDDVLQSSWLRDAPMLQK--AKRL-MKLDGMEIEEENF 466
            .|.:.|....|...:|:.       :|||  .||| .|.|.|||:...|
  Rat   407 PLQLKPNITNSARHLLEG-------LLQKDRTKRLGAKDDFMEIKSHIF 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 8/53 (15%)
STKc_Chk2 167..441 CDD:270986 75/274 (27%)
S_TKc 174..441 CDD:214567 74/267 (28%)
Sgk1XP_006227785.1 S_TKc 192..449 CDD:214567 86/297 (29%)
STKc_SGK 196..518 CDD:270727 86/293 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.