DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Nek8

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001099274.1 Gene:Nek8 / 287473 RGDID:1306897 Length:698 Species:Rattus norvegicus


Alignment Length:264 Identity:81/264 - (30%)
Similarity:135/264 - (51%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 RKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDR--VLNEAKIMKNLSHPCV 240
            |.:|.||:|:|.|      |.:   |..:|.::....|....:..:|  ..||.:::|.|:||.|
  Rat     8 RVVGRGAFGIVHL------CLR---KADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNHPNV 63

  Fly   241 VRMHDIVDKPDSVYMVLEFMRGGDLLNRIIS--NKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303
            :..::...:..::.:.:|:..||.|...|..  |.||.|:....:|.|:..|:.::|...|.|||
  Rat    64 IEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVHTHLILHRD 128

  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVDIWS 368
            ||..|:||:.:  ..::|:.|||:||.:...|...|:.|||.|::|| |..|  :.|.:|.|||:
  Rat   129 LKTQNILLDKH--RMVVKIGDFGISKILSSKSKAYTVVGTPCYISPE-LCEG--KPYNQKSDIWA 188

  Fly   369 LGVVLFTCLSGTLPFSDEYGTPA-AQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSI 432
            ||.||:...|....| :....|| ..:|..|.||   |.....|...:.|:..:|.::|.:||.:
  Rat   189 LGCVLYELASLKRAF-EAANLPALVLKIMSGTFA---PISDRYSPELRQLVLSLLSLEPAQRPPL 249

  Fly   433 DDVL 436
            ..::
  Rat   250 SHIM 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 81/264 (31%)
S_TKc 174..441 CDD:214567 81/264 (31%)
Nek8NP_001099274.1 STKc_Nek8 3..258 CDD:270859 81/264 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..307
ATS1 318..663 CDD:227511
RCC1 1 415..466
RCC1 2 467..518
RCC1 3 520..571
RCC1 4 585..636
RCC1 5 638..689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.