DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and cmk1

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_593464.1 Gene:cmk1 / 2542442 PomBaseID:SPACUNK12.02c Length:335 Species:Schizosaccharomyces pombe


Alignment Length:333 Identity:110/333 - (33%)
Similarity:164/333 - (49%) Gaps:26/333 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 TYK--AFVFKDLSPNESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLS 211
            |||  ....||.:|..::...:.:...|.|.|.||.|.|..||......|.:.:|.||:.|.|:.
pombe     4 TYKPNTSALKDGAPKATVDQKQLLPCKYRVGRVLGGGTYATVREAVHIETNKMYAAKIMNKKMME 68

  Fly   212 GARPSTNFSDPDRVLNEAKIMKNLS--HPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKL 274
                    ...|.|.||..|:|.:|  ||.::.:.|..:..:::|::.|...||:|.:||.:...
pombe    69 --------KKQDFVKNEIAILKRVSYEHPNILHLVDFFETVNNLYLITELATGGELFDRICAKGS 125

  Fly   275 LSEDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDS---V 336
            ..|..:.........|||||||.||.||||||:|:|..:.|..:.|.::|||||.|.: ||   :
pombe   126 FYEADAAALMRTTTSAVKYLHDNGIVHRDLKPENLLYRSKDPNSDLLIADFGLSHFYE-DSQYYM 189

  Fly   337 MRTLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFA 401
            :.|.||||.|:||||.   .|..|.|.||:|::||:.:..|||..||:........:.|....:.
pombe   190 LMTACGTPEYMAPEVF---RRTGYGKPVDMWAIGVITYFLLSGYTPFARPSQVEVIEAILANEYT 251

  Fly   402 YGHPSWKSVSQRAKLLINQMLIVDPERRPSIDDVLQSSWLRDAPMLQKAKRLMKLDGMEIEEENF 466
            :..|.|..:|:.||..|.:.|..||.:|.:..|.|:..:|.:       ||....:.:....|||
pombe   252 FNDPCWSGISETAKDFIKKCLENDPSKRLTAADALKHPFLSE-------KRPATSNLLPNVRENF 309

  Fly   467 LEPPTKRS 474
            ....|.|:
pombe   310 NARKTFRT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 3/8 (38%)
STKc_Chk2 167..441 CDD:270986 96/278 (35%)
S_TKc 174..441 CDD:214567 96/271 (35%)
cmk1NP_593464.1 STKc_CAMK 30..290 CDD:270687 96/271 (35%)
S_TKc 31..291 CDD:214567 96/271 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.