DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Dclk3

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_766516.2 Gene:Dclk3 / 245038 MGIID:3039580 Length:790 Species:Mus musculus


Alignment Length:280 Identity:95/280 - (33%)
Similarity:168/280 - (60%) Gaps:24/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 EINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMK 233
            ::.|.|.:...:|.|.:..|:......|.|.:|||::.|:.|.|..        |.|.:|..|::
Mouse   509 DVEKHYDIGGVIGDGNFATVKECRHRETKQAYAMKMIDKSQLKGKE--------DIVDSEILIIQ 565

  Fly   234 NLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRG 298
            :||||.:|::|::.:....:|:::|:::||||.:.|:.|....|..:.:....:|.|:.::||:.
Mouse   566 SLSHPNIVKLHEVYETEAEIYLIMEYVQGGDLFDAIVENVKFPEPEAAVMITDLCKALVHMHDKN 630

  Fly   299 ITHRDLKPDNVLLETNDEETL-LKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTK 362
            |.|||:||:|:|::.|::::: ||::||||:|:|.:.  :.|:||||.|||||:|   ..:.|..
Mouse   631 IVHRDVKPENLLVQRNEDKSITLKLADFGLAKYVVRP--IFTVCGTPTYVAPEIL---SEKGYGL 690

  Fly   363 KVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQ------IKKGRFAYGHPSWKSVSQRAKLLINQM 421
            :||:|:.||:|:..|.|..||.    :|...|      |:.|:|.:..|.|.::|..||.|:..:
Mouse   691 EVDMWAAGVILYILLCGFPPFR----SPERDQDELFNIIQVGQFEFLSPYWDNISDAAKDLVRNL 751

  Fly   422 LIVDPERRPSIDDVLQSSWL 441
            |.|||::|.:.:.|||..|:
Mouse   752 LEVDPKKRYTAEQVLQHPWI 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 94/278 (34%)
S_TKc 174..441 CDD:214567 93/273 (34%)
Dclk3NP_766516.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
UBQ 92..177 CDD:294102
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..290
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..506
PKc_like 513..770 CDD:304357 93/273 (34%)
S_TKc 514..771 CDD:214567 93/273 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101842
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.