DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and SIK2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_056006.1 Gene:SIK2 / 23235 HGNCID:21680 Length:926 Species:Homo sapiens


Alignment Length:268 Identity:83/268 - (30%)
Similarity:151/268 - (56%) Gaps:16/268 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHP 238
            |.:...||.|.:.:|:|.....|..:.|:||:.|:.|...       :.:::..|.:|||.|.||
Human    20 YDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAV-------NLEKIYREVQIMKMLDHP 77

  Fly   239 CVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303
            .:::::.:::....:|:|.|:.:.|::.:.:.::..|:|..::..|:|:..||.|.|.|.|.|||
Human    78 HIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVHRD 142

  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVDIWS 368
            ||.:|:||:.|..   :|::|||...|.:...::.|.||:|.|.||||.  .|::....::||||
Human   143 LKAENLLLDNNMN---IKIADFGFGNFFKSGELLATWCGSPPYAAPEVF--EGQQYEGPQLDIWS 202

  Fly   369 LGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSID 433
            :||||:..:.|.|||.........|::.:|||...:    .:|:..:.||.:||::||.:|.:|.
Human   203 MGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPY----FMSEDCEHLIRRMLVLDPSKRLTIA 263

  Fly   434 DVLQSSWL 441
            .:.:..|:
Human   264 QIKEHKWM 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 82/266 (31%)
S_TKc 174..441 CDD:214567 82/266 (31%)
SIK2NP_056006.1 STKc_SIK 19..271 CDD:270973 82/266 (31%)
UBA_SIK2 297..341 CDD:270592
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 644..666
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 742..776
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 801..896
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.