DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and STK38L

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_024304657.1 Gene:STK38L / 23012 HGNCID:17848 Length:521 Species:Homo sapiens


Alignment Length:344 Identity:84/344 - (24%)
Similarity:133/344 - (38%) Gaps:108/344 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 LGSGAYGLVRLVYDTRTCQQFAMKIVKK-NMLSGARPSTNFSDPDRVLNEAKIMKNLSHPCVVRM 243
            :|.||:|.||||....|...:||||::| :||...:.:       .:..|..|:.......||:|
Human    96 IGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVA-------HIRAERDILVEADGAWVVKM 153

  Fly   244 HDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRDLKPDN 308
            ........::|:::||:.|||::..::....|:|:.::.|..:...|:..:|..|..|||:||||
Human   154 FYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDN 218

  Fly   309 VLLETNDEETLLKVSDFGL------------------------------------------SKFV 331
            :||   |.:..:|:|||||                                          .|.:
Human   219 LLL---DAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFCKFGCCFSSFPWLRYCREQKVL 280

  Fly   332 QKDSVMRTLC---------------------------------------------------GTPL 345
            ....::..||                                                   |||.
Human   281 SLSPLLNPLCFRCICIFFLWRAFFPRDYNSILLKLAFQNMNSKRKAETWKKNRRQLAYSTVGTPD 345

  Fly   346 YVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSV 410
            |:||||.:..|   |.|..|.|||||:::..|.|..||..|......:::...:.....|....:
Human   346 YIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPI 407

  Fly   411 SQRAKLLINQMLIVDPERR 429
            |::||.||.:..| |.|.|
Human   408 SEKAKDLILRFCI-DSENR 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 84/344 (24%)
S_TKc 174..441 CDD:214567 84/344 (24%)
STK38LXP_024304657.1 STKc_NDR2 87..509 CDD:270776 84/344 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.