DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Camk1g

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_011237234.1 Gene:Camk1g / 215303 MGIID:2388073 Length:491 Species:Mus musculus


Alignment Length:286 Identity:103/286 - (36%)
Similarity:158/286 - (55%) Gaps:27/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 INKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKN 234
            |.||:.....|||||:..|.||....|.:.||:|.:||        |..|.| ..:.||..::|.
Mouse    19 IRKTFIFMEVLGSGAFSEVFLVKQRVTGKLFALKCIKK--------SPAFRD-SSLENEIAVLKR 74

  Fly   235 LSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGI 299
            :.|..:|.:.||.:.....|:|::.:.||:|.:||:...:.:|..:.|...|:..||||||:.||
Mouse    75 IKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGI 139

  Fly   300 THRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYV--------------APE 350
            .||||||:|:|..|.:|.:.:.::|||||| ::::.||.|.||||.||              |||
Mouse   140 VHRDLKPENLLYLTPEENSKIMITDFGLSK-MEQNGVMSTACGTPGYVAHREGKSRKDLKKEAPE 203

  Fly   351 VLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAK 415
            ||   .::.|:|.||.||:||:.:..|.|..||.:|..:...::||:|.:.:..|.|..:|:.||
Mouse   204 VL---AQKPYSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAK 265

  Fly   416 LLINQMLIVDPERRPSIDDVLQSSWL 441
            ..|..:|..||..|.:.:..|:..|:
Mouse   266 DFICHLLEKDPNERYTCEKALRHPWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 102/284 (36%)
S_TKc 174..441 CDD:214567 99/280 (35%)
Camk1gXP_011237234.1 STKc_CaMKI_gamma 19..317 CDD:271068 103/286 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.