DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and pak-2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_505809.2 Gene:pak-2 / 179527 WormBaseID:WBGene00006443 Length:522 Species:Caenorhabditis elegans


Alignment Length:316 Identity:92/316 - (29%)
Similarity:154/316 - (48%) Gaps:62/316 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 RKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHPCVVR 242
            :::|.|:.|:|...|...|.|..|:|  :.|:....|....|       ||..|::...||.:||
 Worm   235 KQIGEGSTGVVEAAYKISTKQIVAVK--RMNLRKQQRRELLF-------NEVSILRQYQHPNIVR 290

  Fly   243 MHD--IVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRDLK 305
            ...  :||  |.:::|:|||.||.|.:.:.:.::....|:.: ..|:..|:.:||.|.:.|||:|
 Worm   291 FFSSHLVD--DELWVVMEFMEGGSLTDIVTATRMTEPQIATI-SRQVLGALDFLHARKVIHRDIK 352

  Fly   306 PDNVLLETNDEETLLKVSDFG----LSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVDI 366
            .|::||:   .:..:|::|||    ||:.|.:   .|:|.|||.:.|.||:   .||.|..:.||
 Worm   353 SDSILLK---RDGTVKLTDFGFCGQLSEEVPR---RRSLVGTPYWTAAEVI---AREPYDTRADI 408

  Fly   367 WSLGVVLFTCLSGTLPFSDEYGTPAAQQIK---KGRFAYGHPSWKSVSQRAKL------LINQML 422
            ||.|::|...:.|..||.::....|.::|:   :.||          |:.||:      |::..:
 Worm   409 WSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARF----------SRHAKVSVELSELLSHCI 463

  Fly   423 IVDPERRPSIDDVLQSSWLRDAPMLQKAKR-------LMKLDGMEIEEENFLEPPT 471
            :.|..:|....|:|:.      |...||:.       |::|.|..|...|   |||
 Worm   464 VKDVNKRWPAKDLLRH------PFFAKAQHSSSIAPLLLQLQGNTINGNN---PPT 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 81/277 (29%)
S_TKc 174..441 CDD:214567 81/277 (29%)
pak-2NP_505809.2 CRIB_PAK_like 14..60 CDD:238526
PKc_like 223..483 CDD:304357 82/284 (29%)
S_TKc 232..482 CDD:214567 82/283 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.