DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Mapkapk2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_032577.1 Gene:Mapkapk2 / 17164 MGIID:109298 Length:386 Species:Mus musculus


Alignment Length:316 Identity:96/316 - (30%)
Similarity:164/316 - (51%) Gaps:40/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 INKTYYV-NRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMK 233
            |...|.| ::.||.|..|.|..::|.||.|:||:|:::              |..:...|.::..
Mouse    45 ITDDYKVTSQVLGLGINGKVLRIFDKRTQQKFALKMLQ--------------DCPKARREVELHW 95

  Fly   234 NLSHPCVVRMHDIVDKPDSVY-------MVLEFMRGGDLLNRI--ISNKLLSEDISKLYFYQMCH 289
            ..|. |...:| |||..:::|       :|:|.:.||:|.:||  ..::..:|..:......:..
Mouse    96 RASQ-CPHIVH-IVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGE 158

  Fly   290 AVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLIT 354
            |::|||...|.|||:||:|:|..:.....:||::|||.:|.....:.:.|.|.||.|||||||  
Mouse   159 AIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVL-- 221

  Fly   355 GGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYG---TPAAQ-QIKKGRFAYGHPSWKSVSQRAK 415
             |.|.|.|..|:|||||:::..|.|..||...:|   :|..: :|:.|::.:.:|.|..||:..|
Mouse   222 -GPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVK 285

  Fly   416 LLINQMLIVDPERRPSIDDVLQSSWLRDAPMLQK----AKRLMKLD---GMEIEEE 464
            :||..:|..:|.:|.:|.:.:...|:..:..:.:    ..|::|.|   ..:::||
Mouse   286 MLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 90/284 (32%)
S_TKc 174..441 CDD:214567 89/280 (32%)
Mapkapk2NP_032577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
STKc_MAPKAPK2 47..349 CDD:271072 95/314 (30%)
Staurosporine binding. /evidence=ECO:0000250 125..127 1/1 (100%)
Autoinhibitory helix 314..350 5/28 (18%)
Nuclear export signal (NES) 331..354 3/11 (27%)
Nuclear export signal (NES). /evidence=ECO:0000250 342..351 96/316 (30%)
p38 MAPK-binding site. /evidence=ECO:0000250 352..376
Bipartite nuclear localization signal 1 357..360
Bipartite nuclear localization signal 2 371..375
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.