DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and nek8

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_620776.1 Gene:nek8 / 171094 ZFINID:ZDB-GENE-020509-1 Length:697 Species:Danio rerio


Alignment Length:274 Identity:88/274 - (32%)
Similarity:145/274 - (52%) Gaps:27/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVL--NEAK 230
            |:..||    :.:|.||:|:|.|   .|.....|:.|:|:      .|....:..:|:.  ||.:
Zfish     2 EKYEKT----KVVGRGAFGIVHL---CRRRTDSALVILKE------IPVEQMTRDERLAAQNECQ 53

  Fly   231 IMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIIS--NKLLSEDISKLYFYQMCHAVKY 293
            ::|.||||.::..::...:..::.:.:|:..||.|.:.|..  |.||.||.....|.|:..|:.:
Zfish    54 VLKLLSHPNIIEYYENFLEDKALMIAMEYAPGGTLADYIQKRCNSLLDEDTILHSFVQILLALYH 118

  Fly   294 LHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGRE 358
            :|::.|.|||||..|:||:.:  :.::|:.|||:||.:...|...|:.|||.|::|| |..|  :
Zfish   119 VHNKLILHRDLKTQNILLDKH--QMIVKIGDFGISKILVSKSKAYTVVGTPCYISPE-LCEG--K 178

  Fly   359 AYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPA-AQQIKKGRFAYGHPSWKSVSQRAKLLINQML 422
            .|.:|.|||:||.||:...|....| :....|| ..:|..|.||   |.....|...:.||..||
Zfish   179 PYNQKSDIWALGCVLYELASLKRAF-EAANLPALVLKIMSGTFA---PISDRYSPELRQLILNML 239

  Fly   423 IVDPERRPSIDDVL 436
            .:||.:||.:::::
Zfish   240 NLDPSKRPQLNEIM 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 88/274 (32%)
S_TKc 174..441 CDD:214567 85/268 (32%)
nek8NP_620776.1 STKc_Nek8 3..258 CDD:270859 87/273 (32%)
S_TKc 4..255 CDD:214567 87/272 (32%)
ATS1 309..662 CDD:227511
RCC1 1 417..468
RCC1 2 469..520
RCC1 3 521..586
RCC1 4 587..636
RCC1 5 637..689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.