DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and DCLK2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001035351.4 Gene:DCLK2 / 166614 HGNCID:19002 Length:783 Species:Homo sapiens


Alignment Length:419 Identity:113/419 - (26%)
Similarity:187/419 - (44%) Gaps:81/419 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PEKILTRISKVHFIIKRANCELTNPVYIQDLSRNGT--FVNNEKIGTNRM----RILKNDDVISL 145
            |||.  |.::..|::..:.|.:....|    ||:..  :..::..|.:|.    ..:|.....|.
Human   271 PEKF--RYAQDDFVLDHSECRVLKSSY----SRSSAVKYSGSKSPGPSRRSKSPASVKRGGHYSS 329

  Fly   146 SHPTYKAFV------------------FKDLSPNESIGL------------------------PE 168
            ::.|.|:.|                  ....||....||                        ||
Human   330 AYSTAKSPVNGTPSSQLSTPKSTKSSSSSPTSPGSFRGLKQISAHGRSSSNVNGGPELDRCISPE 394

  Fly   169 EIN-----------KTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDP 222
            .:|           :.|.:.:.:|.|.:.:|:...|..|.::||:||:.|....|..        
Human   395 GVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKE-------- 451

  Fly   223 DRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQM 287
            ..:.||..|::.:.||.::.:.:.::....:::|:|.::||||.:.|.|:...:|.......|.:
Human   452 HLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNL 516

  Fly   288 CHAVKYLHDRGITHRDLKPDNVLL-ETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEV 351
            .:|::|||...|.|||:||:|:|: |..|....||:.||||:..|  :..:.|:||||.|||||:
Human   517 ANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVV--EGPLYTVCGTPTYVAPEI 579

  Fly   352 LITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYG--TPAAQQIKKGRFAYGHPSWKSVSQRA 414
            :...|   |..|||||:.||:.:..|.|..||..|..  .....||..|:..:..|.|.:::..|
Human   580 IAETG---YGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSA 641

  Fly   415 KLLINQMLIVDPERRPSIDDVLQSSWLRD 443
            |.||:|||.|:.|.|.:...:|...|:.|
Human   642 KELISQMLQVNVEARCTAGQILSHPWVSD 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 16/92 (17%)
STKc_Chk2 167..441 CDD:270986 91/287 (32%)
S_TKc 174..441 CDD:214567 88/269 (33%)
DCLK2NP_001035351.4 DCX 67..157 CDD:214711
DCX 192..280 CDD:214711 4/10 (40%)
STKc_DCKL2 409..667 CDD:271086 88/270 (33%)
S_TKc 411..668 CDD:214567 88/269 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.