DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and PDIK1L

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001230461.1 Gene:PDIK1L / 149420 HGNCID:18981 Length:341 Species:Homo sapiens


Alignment Length:350 Identity:92/350 - (26%)
Similarity:145/350 - (41%) Gaps:101/350 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRV---LNEAKIMKNL 235
            |.:.|::|.|:||:|......:|..:.|:|.::.:.            |:.|   |.|...:.::
Human     8 YDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHA------------PENVELALREFWALSSI 60

  Fly   236 --SHP-------CVVRMHDIVDK-------------------------PDSVY---MVLEFMRGG 263
              .||       |:::...:|.|                         |.|.|   .|::|..||
Human    61 KSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVETSLKGEIAFDPRSAYYLWFVMDFCDGG 125

  Fly   264 DLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVL-----LETNDEETLLKVS 323
            |:...::|.| .:...:..:..|:..|:.:||...|.||||||||:|     |:|:|.|..|||:
Human   126 DMNEYLLSRK-PNRKTNTSFMLQLSSALAFLHKNQIIHRDLKPDNILISQTRLDTSDLEPTLKVA 189

  Fly   324 DFGLSKFVQKDS------------VMRTLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTC 376
            ||||||......            .:.|.|||..|:||||    ....||.|.||::||::::..
Human   190 DFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPEV----WEGHYTAKADIFALGIIIWAM 250

  Fly   377 LSGTLPFSD---------EYGTPAAQQIKKGRFAYGHPSW--------KSVSQRAKLLINQMLIV 424
            |. .:.|.|         .|.....:.:..|.....:|..        ||::.|.|.||.:||..
Human   251 LE-RITFIDTETKKELLGSYVKQGTEIVPVGEALLENPKMELLIPVKKKSMNGRMKQLIKEMLAA 314

  Fly   425 DPERRPSIDDV---------LQSSW 440
            :|:.||...::         ..|||
Human   315 NPQDRPDAFELELRLVQIAFKDSSW 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 91/349 (26%)
S_TKc 174..441 CDD:214567 91/349 (26%)
PDIK1LNP_001230461.1 STKc_PDIK1L 7..331 CDD:270879 89/340 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.