DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Dapk2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_036010488.1 Gene:Dapk2 / 13143 MGIID:1341297 Length:490 Species:Mus musculus


Alignment Length:308 Identity:84/308 - (27%)
Similarity:152/308 - (49%) Gaps:19/308 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SPNESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPD 223
            |||......:::...|.:..:||||.:.:|:...:..|..::|.|.:||.....:|......:.:
Mouse     8 SPNMETFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVCREEIE 72

  Fly   224 RVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMC 288
            |   |..|::.:.||.::.:||:.:....|.::||.:.||:|.:.:...:.|||:.:..:..|:.
Mouse    73 R---EVSILRQVLHPNIITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQIL 134

  Fly   289 HAVKYLHDRGITHRDLKPDNV-LLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVL 352
            ..|.|||.:.|.|.||||:|: ||:.|.....:|:.||||:..::.....:.:.|||.:||||::
Mouse   135 DGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIV 199

  Fly   353 ITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLL 417
               ..|....:.|:||:||:.:..|||..||..:........|....:.:....:...|:.||..
Mouse   200 ---NYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDF 261

  Fly   418 INQMLIVDPERRPSIDDVLQSSWL------------RDAPMLQKAKRL 453
            |.::|:.:..:|.:|.:.|:..|:            :..|...|.|||
Mouse   262 IRKLLVKETRKRLTIQEALRHPWITSKGEARAPEQWKAQPAQLKTKRL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 75/274 (27%)
S_TKc 174..441 CDD:214567 75/267 (28%)
Dapk2XP_036010488.1 STKc_DAPK2 17..285 CDD:271098 75/273 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.