DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and AgaP_AGAP003108

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_562866.4 Gene:AgaP_AGAP003108 / 1273778 VectorBaseID:AGAP003108 Length:941 Species:Anopheles gambiae


Alignment Length:311 Identity:69/311 - (22%)
Similarity:133/311 - (42%) Gaps:67/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 PEEINKTY-----YVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVL 226
            |.::|..:     ::.:.||.|.:|.|.:.......:.....:|...||.......:..|   ::
Mosquito   590 PIDLNWEFPRNKLHLGKSLGEGMFGKVVMAEAHGLVKGHPSTVVAVKMLKEGHTDADVKD---LV 651

  Fly   227 NEAKIMKNL-SHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLN-----RIISN---------KLLS 276
            .|.::||.: .|..::.:.....|...:|:::|:...|:|.|     |..||         |:|:
Mosquito   652 CEMEVMKMIGKHVNIINLLGCCCKDGPLYVIVEYAPHGNLKNFLRSHRFGSNYEATNEKEKKILT 716

  Fly   277 EDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMR-TL 340
            :.....:.||:...:::|..|...||||...|:|:..|   .::|::||||::.:......| |.
Mosquito   717 QKELISFAYQIARGMEHLASRRCIHRDLAARNILVSDN---YVMKIADFGLARDIHDQEYYRKTT 778

  Fly   341 CG-TPL-YVAPEVLITGGREAYTKKVDIWSLGVVLFTCLS-GTLPFSDEYGTPAAQQIKKGRFAY 402
            .| .|: ::|||.|   ..:.|..:.|:||.||:|:..:: |..|:      |:.          
Mosquito   779 TGKLPIRWMAPESL---EEKFYDSQSDVWSFGVLLWEIMTLGGNPY------PSI---------- 824

  Fly   403 GHPSWKSVSQRAK----------------LLINQMLIVDPERRPSIDDVLQ 437
              |:|.::.:..|                |.:.:.....||.||:..:::|
Mosquito   825 --PTWDNLLEHLKKGKRMEKPPLCSIEIYLFMRECWHYRPEERPTFSEIVQ 873

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 69/311 (22%)
S_TKc 174..441 CDD:214567 67/304 (22%)
AgaP_AGAP003108XP_562866.4 I-set 95..170 CDD:254352
Ig 98..170 CDD:299845
Ig 291..370 CDD:299845
IG_like 293..370 CDD:214653
IG_like 384..473 CDD:214653
Ig 393..474 CDD:299845
PKc_like 590..880 CDD:304357 69/311 (22%)
STYKc 602..875 CDD:214568 67/299 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.