DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and AgaP_AGAP002710

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_312218.5 Gene:AgaP_AGAP002710 / 1273258 VectorBaseID:AGAP002710 Length:1023 Species:Anopheles gambiae


Alignment Length:352 Identity:90/352 - (25%)
Similarity:146/352 - (41%) Gaps:92/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 VKKNMLSGARPSTNFSDPD--------RVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMR 261
            |.:..|:|...:...|..|        .||.|||:..:|.||.:|.:..:...|.::.:|:|:.|
Mosquito   117 VHRAFLNGEEVAVKASRQDDEFEVARQNVLQEAKLFWSLKHPNIVSLKGVCLDPKTLCLVMEYAR 181

  Fly   262 GGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDR---GITHRDLKPDNVLLETNDE-----ET 318
            ||. ||:|::.:.:..::...:..|:...:||||..   .:.|||||..|||:..:.:     ..
Mosquito   182 GGS-LNKILAGRKIPPNVLVDWAIQIARGMKYLHCEAPISVIHRDLKSSNVLISESIQHGHLLNK 245

  Fly   319 LLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPF 383
            .||::||||::...:.:.| :..||..::.|||:.:|   .|:|..|:||.||:|:..|:|..|:
Mosquito   246 TLKITDFGLAREAYRTTRM-SAAGTFAWMPPEVIKSG---TYSKASDVWSYGVLLWELLTGETPY 306

  Fly   384 SDEYGTPAAQQIKKGRFAYGHP-----SWKSVSQRAKLLINQMLIVDPERRPSIDDV-------- 435
            ........|..:.....|...|     ||..       |:.....:||.||||..|:        
Mosquito   307 KGFDSLSVAYGVAVNTLALPIPKTCPESWGK-------LMKSCWEIDPHRRPSFKDIEKDLDIIA 364

  Fly   436 --------------LQSSWLRD-APMLQK-----------------------------AKRLMKL 456
                          :|..|.:: |.:||:                             |||..:|
Mosquito   365 RSGFAQTPHESFHTMQDGWKKEIAEVLQELRKKEKELRSKEEELTRVQQEQRYKEENLAKREQEL 429

  Fly   457 DGMEIE----EENFL---EPPTKRSRR 476
            ...|||    |...|   ..||.:.|:
Mosquito   430 HAREIELLGRELKILINQNTPTPKKRK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 74/278 (27%)
S_TKc 174..441 CDD:214567 74/278 (27%)
AgaP_AGAP002710XP_312218.5 SH3_MLK 28..84 CDD:212809
STYKc 103..360 CDD:214568 73/254 (29%)
STKc_MLK 108..363 CDD:270963 73/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.