DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and Stk33

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_473444.1 Gene:Stk33 / 117229 MGIID:2152419 Length:491 Species:Mus musculus


Alignment Length:409 Identity:116/409 - (28%)
Similarity:197/409 - (48%) Gaps:68/409 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NPVYIQDLSRNGTFVNNEKIGTNRMRILKNDDVISLSHPTYKAFVFKDLS--------------- 159
            :||.:.::|:..:..:.|...:...:..:|         |.:....||||               
Mouse    32 SPVLVVEMSQTSSIGSTEFFASQERKKERN---------TSRESSLKDLSIRTSNVERKPQAQWS 87

  Fly   160 -PNESIG-LPE-------EINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARP 215
             .|.::| :|.       .|.:.|...|.||.|::|:|....|..|..::|:|.|.|....    
Mouse    88 RSNVTVGKIPHIRMDDGAGIEEFYTFGRILGQGSFGMVFEAIDKETGAKWAIKKVNKEKAG---- 148

  Fly   216 STNFSDPDRVL-NEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDI 279
                |...::| .|..|:|.::|..::.:..:.:.|..:|:|:|....|:|...:......||:.
Mouse   149 ----SSAMKLLEREVSILKTVNHQHIIHLEQVFESPQKMYLVMELCEDGELKAVMDQRGHFSENE 209

  Fly   280 SKLYFYQMCHAVKYLHDRGITHRDLKPDNVL-----LETNDEETL-LKVSDFGLSKFVQK----- 333
            ::|....:..|:.|||::.|.|||||.:|::     ::.|:|..| :||:|||||  |||     
Mouse   210 TRLIIQSLASAIAYLHNKDIVHRDLKLENIMVKSSFIDDNNEMNLNIKVTDFGLS--VQKHGSRS 272

  Fly   334 DSVMRTLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKG 398
            :.:|:|.||||:|:||||:   ....|:::.||||:||::|..|.|..||.........:.||||
Mouse   273 EGMMQTTCGTPIYMAPEVI---NAHDYSQQCDIWSIGVIMFILLCGEPPFLANSEEKLYELIKKG 334

  Fly   399 RFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSIDDVLQSSWL--------RDAPMLQKAKRLMK 455
            ...:.:|.|:|||..||..:.|::.|||..|.:..::|.:.||        |...:|:..|... 
Mouse   335 ELRFENPVWESVSDSAKNTLKQLMKVDPAHRITAKELLDNQWLTGNTLSSARPTNVLEMMKEWK- 398

  Fly   456 LDGMEIEEENFLEPPTKRS 474
             :..|.:||...:..|::|
Mouse   399 -NNPESDEETNTDEETEQS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 6/45 (13%)
STKc_Chk2 167..441 CDD:270986 94/292 (32%)
S_TKc 174..441 CDD:214567 92/278 (33%)
Stk33NP_473444.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..89 6/46 (13%)
PKc_like 109..377 CDD:419665 92/280 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..491 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44167
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.