DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and PAK4

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001014831.1 Gene:PAK4 / 10298 HGNCID:16059 Length:591 Species:Homo sapiens


Alignment Length:311 Identity:89/311 - (28%)
Similarity:156/311 - (50%) Gaps:39/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LSHPTYKAFVFKDLSPNESIGLPEEINKTYYVN-RKLGSGAYGLVRLVYDTRTCQQFAMKIVKKN 208
            :||..::|.:...:.|.:.        ::|..| .|:|.|:.|:|.:.....:.:..|:|  |.:
Human   299 VSHEQFRAALQLVVDPGDP--------RSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVK--KMD 353

  Fly   209 MLSGARPSTNFSDPDRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNK 273
            :....|....|       ||..||::..|..||.|::.....|.:::|:||:.||.|.:.:...:
Human   354 LRKQQRRELLF-------NEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTR 411

  Fly   274 LLSEDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMR 338
            :..|.|:.:.. .:..|:..||.:|:.|||:|.|::|| |:|..  :|:||||....|.|:...|
Human   412 MNEEQIAAVCL-AVLQALSVLHAQGVIHRDIKSDSILL-THDGR--VKLSDFGFCAQVSKEVPRR 472

  Fly   339 -TLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKG---R 399
             :|.|||.::|||::   .|..|..:|||||||:::...:.|..|:.:|....|.:.|:..   |
Human   473 KSLVGTPYWMAPELI---SRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPR 534

  Fly   400 FAYGHPSWKSVSQRAKLLINQMLIVDPERRPSIDDVLQSSWLRDAPMLQKA 450
            ....|    .||...|..::::|:.||.:|.:..::|:.      |.|.||
Human   535 LKNLH----KVSPSLKGFLDRLLVRDPAQRATAAELLKH------PFLAKA 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 3/10 (30%)
STKc_Chk2 167..441 CDD:270986 81/278 (29%)
S_TKc 174..441 CDD:214567 81/271 (30%)
PAK4NP_001014831.1 CRIB_PAK_like 10..55 CDD:238526
Linker 25..320 4/28 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..301 0/1 (0%)
GEF-interaction domain (GID) 298..323 5/31 (16%)
STKc_PAK4 300..591 CDD:132988 89/310 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.