DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and dclk2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_012811056.1 Gene:dclk2 / 100487296 XenbaseID:XB-GENE-960488 Length:727 Species:Xenopus tropicalis


Alignment Length:297 Identity:96/297 - (32%)
Similarity:155/297 - (52%) Gaps:27/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 NESIGLPEEIN-----------KTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGAR 214
            |..:..||.:|           :.|.:.:.:|.|.:.:|:...:..|.::||:||:.|....|..
 Frog   374 NGLLNSPEGLNGNKFTDASIILEKYKIGKVIGDGNFAVVKECVERSTGKEFALKIIDKAKCCGKE 438

  Fly   215 PSTNFSDPDRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDI 279
                    ..:.||..|::.:.||.::.:.:.:|....:|:|:|.::||||.:.|.|:...:|..
 Frog   439 --------HLIENEVSILRQVKHPNIIMLIEEMDTTAELYLVMELVKGGDLFDAITSSTKYTERD 495

  Fly   280 SKLYFYQMCHAVKYLHDRGITHRDLKPDNVLL-ETNDEETLLKVSDFGLSKFVQKDSVMRTLCGT 343
            :....|.:..|:||||...|.|||:||:|:|: |..|:...||:.||||:..|  |..:.|:|||
 Frog   496 ASAMVYNLASAMKYLHGLHIVHRDIKPENLLVCEYPDKTKSLKLGDFGLATVV--DGPLYTVCGT 558

  Fly   344 PLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYG--TPAAQQIKKGRFAYGHPS 406
            |.|||||::...|   |..|||||:.||:.:..|.|..||..|..  .....||..|:..:..|.
 Frog   559 PTYVAPEIIAETG---YGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILIGKLEFPSPY 620

  Fly   407 WKSVSQRAKLLINQMLIVDPERRPSIDDVLQSSWLRD 443
            |.:::..||.||:.||.|:.|.|.:.:.:|...|:.|
 Frog   621 WDNITDSAKELISCMLQVNVEERYTAEQILSHPWVSD 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 93/287 (32%)
S_TKc 174..441 CDD:214567 90/269 (33%)
dclk2XP_012811056.1 DCX1_DCLK2 70..154 CDD:340661
DCX2 193..276 CDD:340589
STKc_DCKL2 396..654 CDD:271086 90/270 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.