DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and neu4

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001265675.1 Gene:neu4 / 100486976 XenbaseID:XB-GENE-959717 Length:483 Species:Xenopus tropicalis


Alignment Length:36 Identity:12/36 - (33%)
Similarity:17/36 - (47%) Gaps:10/36 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 LITGGREAYT----------KKVDIWSLGVVLFTCL 377
            :|..|..||:          :|..:.||.||:|.||
 Frog   399 VIYEGPSAYSDLAYLGPPSGEKSAMGSLPVVVFACL 434

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 12/36 (33%)
S_TKc 174..441 CDD:214567 12/36 (33%)
neu4NP_001265675.1 Sialidase_non-viral 10..452 CDD:271234 12/36 (33%)
Sialidase propeller 1 22..75 CDD:271234
Sialidase propeller 2 84..142 CDD:271234
Sialidase propeller 3 157..215 CDD:271234
Sialidase propeller 4 222..264 CDD:271234