DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and LOC100485259

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_002933099.1 Gene:LOC100485259 / 100485259 -ID:- Length:605 Species:Xenopus tropicalis


Alignment Length:343 Identity:94/343 - (27%)
Similarity:163/343 - (47%) Gaps:62/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 INKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRV--LNEAKIM 232
            |...|.:...||.|.||.|:...:..|.:..|:|.::|:.::..|        |||  ..|.:|.
 Frog    64 IKHRYELLETLGRGTYGKVKRATEKATGKMVAVKSIQKDKITDER--------DRVHLQREIEIT 120

  Fly   233 KNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDR 297
            ..|.|..::|:.::.:..|.:.:|:|:...|:|.:.|.:...:.|:.::.:|.|:..||.|.|.:
 Frog   121 ALLQHEHIIRVFEVFESRDKIIIVMEYASNGELYDFINNKHQIPENDARRFFRQIVSAVHYCHKK 185

  Fly   298 GITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTK 362
            ||.|||:|.:|:||   |:...:|::|||||...||..|:.|.||:|||.:||  |..|......
 Frog   186 GIVHRDIKLENILL---DDNLNVKLADFGLSNHFQKHQVLETYCGSPLYASPE--IVKGLPYQGP 245

  Fly   363 KVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRF--------AYGHPSWKSVSQRAKLLIN 419
            :||.|:|||:|:..:.|.:||.:......|:||.:|::        |:|             |::
 Frog   246 EVDCWALGVLLYALVYGIMPFENSNYKSLAEQISRGQYREPPHLSGAFG-------------LVD 297

  Fly   420 QMLIVDPERRPSIDDVLQSSWLR----------------DAPMLQKAKRLMKLDGM--------- 459
            .||.|:...|.:|:|:....|:.                .:|:|.:........|.         
 Frog   298 WMLTVNTSSRATIEDIANHWWVNWGYDTVVCDCELAPECHSPLLARYIECQNTQGFQMTTMEHQQ 362

  Fly   460 -EIEEENFLEPPTKRSRR 476
             |:.:|...|...::|::
 Frog   363 DELRKEEEYEVCLRKSKK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 86/280 (31%)
S_TKc 174..441 CDD:214567 85/276 (31%)
LOC100485259XP_002933099.1 STKc_NUAK 67..319 CDD:270975 85/277 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.