DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL3 and AANAT1

DIOPT Version :9

Sequence 1:NP_610018.1 Gene:AANATL3 / 35285 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster


Alignment Length:222 Identity:67/222 - (30%)
Similarity:103/222 - (46%) Gaps:31/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TIRTMTKEDYPSVKAFLKDNFFQSEPL--------CQSTSENVQSQNEKENDEYHLSMIAQGTCL 66
            ||..:..||..:|.|.||..||:.|||        |            ||.::|.|..:......
  Fly    58 TIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGEC------------KELEKYSLKPLPDNCSY 110

  Fly    67 VAIDESNGGKFVGLVLAGAQ---YPEDL-EKHRIEAESMEQHFWARACIMLSKIEREANLFERFG 127
            .|:::.  |:.:|:.|.|..   .|:|: ||   .|:|.|...:.:...::..:|.:.|:|:.:.
  Fly   111 KAVNKK--GEIIGVFLNGLMRRPSPDDVPEK---AADSCEHPKFKKILSLMDHVEEQFNIFDVYP 170

  Fly   128 ISKL-LYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYCTSFYSARQKEALGMKCVHS 191
            ..:| |...|.||:::.||.|:..||.....:..|..|.......|:|.||||..|.||...|..
  Fly   171 DEELILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFR 235

  Fly   192 LPYADYKDDQGRPIFTPAEPHTMARIM 218
            :.:|||| .||..:|.||.||...::|
  Fly   236 MQFADYK-PQGEVVFKPAAPHVGIQVM 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 19/60 (32%)
AANAT1NP_995934.1 RimI <168..235 CDD:223532 22/66 (33%)
NAT_SF <183..227 CDD:302625 14/43 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.