DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL3 and AANATL4

DIOPT Version :9

Sequence 1:NP_610018.1 Gene:AANATL3 / 35285 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster


Alignment Length:224 Identity:129/224 - (57%)
Similarity:169/224 - (75%) Gaps:2/224 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASSIKDGITIRTMTKEDYPSVKAFLKDNFFQSEPLCQSTSENVQSQNEKENDEYHLSMIAQGTC 65
            |..:..||:|||.|..|||..|||:::..::.|||||||:.|.|..|||:.||.::.|:||:||.
  Fly     1 MTPTTIDGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTS 65

  Fly    66 LVAIDESNGGKFVGLVLAGAQYPEDLEKH--RIEAESMEQHFWARACIMLSKIEREANLFERFGI 128
            |:|:||::||:.||||||.|.||:::...  .::.|::|.:.|.|...:|.|.:||.|||||:.|
  Fly    66 LLALDENDGGRIVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNLFERYDI 130

  Fly   129 SKLLYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYCTSFYSARQKEALGMKCVHSLP 193
            .|.||||:|||.|..||||||||||||||::||:.|||.|.|:||||||||||.||||:|::|:.
  Fly   131 PKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIYSID 195

  Fly   194 YADYKDDQGRPIFTPAEPHTMARIMFIKL 222
            |||||||:||.|||||.|||..|:|.|||
  Fly   196 YADYKDDEGRVIFTPAAPHTKLRVMAIKL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 44/59 (75%)
AANATL4NP_611406.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435007
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I7474
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 1 1.000 - - mtm9663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.